PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10005010m
Common NameCICLE_v10004984mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 432aa    MW: 48305.3 Da    PI: 5.8107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10005010mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32192246155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k r+rWtpeLHe+Fveav++LGG e+AtPk +l+lm+v+ Lt++hvkSHLQkYR+
  Ciclev10005010m 192 KSRMRWTPELHEAFVEAVNRLGGGERATPKGVLKLMNVENLTIYHVKSHLQKYRT 246
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.21189249IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-31191249IPR009057Homeodomain-like
SuperFamilySSF466895.38E-18191247IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24192246IPR006447Myb domain, plants
PfamPF002496.2E-11194245IPR001005SANT/Myb domain
PfamPF143791.2E-21277323IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MSNPQQISAS SSRFPDNMHF SSVSPHGRYS QNSPFISQSL RDEARLRSTH FSPSEGQPTP  60
LINHPEENKD NSWCIDPLQD FLDFPENDPG QTGLLESNTG DIASDDRAKR IEWWADQLIS  120
VEDGPEPNWS EVLADVNVTD ARQKVLKPST DIPTQHPQVH PQVHPQGQQH QPVSNEEFHA  180
VANPLSMTPA NKSRMRWTPE LHEAFVEAVN RLGGGERATP KGVLKLMNVE NLTIYHVKSH  240
LQKYRTARHR PESSEGTSEK KSNPTEDMKS LDTKTTMSIT EALRLQMEVQ KRLHEQLEIQ  300
RNLQLRIEEQ GRHLQMMFEQ RKQMENEKSK ASSSSLENPS APLFESKQHS SPNETSMATE  360
LDVAKTGADT SHVISAPEDS SASLNQKQKA PETKTGEEVD PDDDESGHKP VKRARSEATA  420
FSPKSALGNT L*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006420650.10.0hypothetical protein CICLE_v10004984mg
RefseqXP_006420651.10.0hypothetical protein CICLE_v10004984mg
SwissprotQ8GUN52e-95PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLV4S4Z50.0V4S4Z5_9R
STRINGPOPTR_0019s03750.11e-164(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.36e-95G2-like family protein